PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi08g21650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 242aa    MW: 27351.5 Da    PI: 6.6092
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi08g21650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.3e-14124168347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Vradi08g21650.1 124 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 168
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.3881266IPR017877Myb-like domain
SuperFamilySSF466892.51E-101465IPR009057Homeodomain-like
SMARTSM007172.0E-41668IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-41666IPR009057Homeodomain-like
CDDcd001672.25E-51962No hitNo description
PROSITE profilePS5129420.673117173IPR017930Myb domain
SuperFamilySSF466894.74E-17118173IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17120172IPR006447Myb domain, plants
SMARTSM007177.3E-11121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-11121167IPR009057Homeodomain-like
PfamPF002496.6E-12124168IPR001005SANT/Myb domain
CDDcd001671.12E-9124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MFHESSVTRW QPQPVQPTEW TRYHDKLFER ALLLVPEDLP DRWNQIAVHV PGKTPAEVRE  60
HYDALVHDVF EIDSGRVEVP SYVDDLAPPQ LSGGAGNSAW DSANQISFGS KPKQGETERK  120
KGTPWTEEEH RLFLIGLSKF GKGDWRSISR NVVVTRTPTQ VASHAQKYFL RQNSGKKERK  180
RSSIHDITTV DSNSLPVPID QNWVPPPGTS MQQSQDMLSY ASTSMHDQMG PFGYSNYGFE  240
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1420821173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512566.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0L9U1R51e-178A0A0L9U1R5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SLK81e-178A0A0S3SLK8_PHAAN; Uncharacterized protein
STRINGGLYMA20G24600.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-80MYB family protein